DPCstruct | MC26845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1F169 | 1-64 | MNVQRAQEIASSPVMANVLLDGTPIYIQHVDELSETARVYPLDNPEAEREVPLYSLEEQDHFLG |
| A0A178TU78 | 1-72 | MTNTTKERDVNMNINRVKQIVSSPADIPVYYNGVSVWIDDYNEQEETATIHLRDGHLREQREVPVEELTEKQ |
| A0A7C6VTK1 | 1-57 | None |
| A0A6N8CMH5 | 22-92 | None |
| C3FYA6 | 13-82 | None |
| Q2BAQ1 | 43-110 | None |
| A0A7X3D7V6 | 1-58 | None |
| A0A5P9HQM6 | 7-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.