DPCstruct | MC2684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E2M8F0 | 8-140 | PEFIQEIRVNQQRKQSDKSKEKLEIAISYTQHEFAPYVSDDDLKELCQHITAYSEGNILQNPQPVRVVKLTSLDLYHFGWNIWKHFS… |
| H1Q2U0 | 14-155 | VFINQVQIDRKQMNEAKVAREAKKQEAILKYTRYTLMPHGFTDEELYQIEEAVKLLVELNGVTRMEVLSIGKKKDLKQADLKNFCWN… |
| A0A1G7GU36 | 28-201 | None |
| A0A4Y1X876 | 23-162 | None |
| C6Z992 | 46-187 | None |
| A0A1I5IWU1 | 174-353 | None |
| A0A0D0IWW6 | 228-414 | None |
| A0A3N2N7V0 | 251-397 | None |
| R9H976 | 81-246 | None |
| A0A1Q6IPV2 | 73-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.