DPCstruct | MC26839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 233 ± 20 aa |
| Standard deviation of domain lengths | 19.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9F3Y0 | 54-299 | MNDEAMKDWKIEIHRFIWLSVARFLIMFTEKMRQTLVAEDFHHSYWKILQYVMSSNSRFHMQNFGRKADFLEMEFDPSELMRYTSIN… |
| A0A818GG90 | 2-218 | LFIQLCAFKIDDDCFPLLDVLSFVMNPTGRYHQANHNRTSLYHLKNDSEPFAATMEYRFPQRGWLVDFINKFGELGGFDKILNRFTS… |
| A0A397CMS2 | 59-299 | None |
| A0A818CFT4 | 140-406 | None |
| A0A818KN08 | 18-226 | None |
| A0A814MB30 | 15-245 | None |
| A0A819JKZ3 | 115-341 | None |
| A0A1I8IFQ7 | 2-257 | None |
| A0A820EE53 | 7-223 | None |
| A0A2P8XDA9 | 102-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.