DPCstruct | MC2683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 209 ± 36 aa |
| Standard deviation of domain lengths | 36.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 18.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7I169 | 10-232 | ITEMAYTAKQLVMLYKSETALANDPILKPVFAQIEPLAEALSQAIKSDKILSEVDKADDVRDELVRQLEKYLKSYANIPVENLRKSG… |
| H1Q0N9 | 21-235 | SHVLRLCEEANLPKLNDALPPLVRAINNEDRALNRPRRLPGTEELRLLDKERDNAYQALRLLMMAQIRSDDDAVVKAAKVLEEVMSR… |
| E6K9F7 | 56-276 | None |
| A0A1G6SWZ0 | 3-186 | None |
| A0A7M4D2F1 | 18-156 | None |
| E0NTC4 | 22-233 | None |
| A0A4P2PVN7 | 1-269 | None |
| A0A6P1QWB3 | 8-204 | None |
| V6S736 | 77-308 | None |
| A0A7X6XE28 | 1-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.