DPCstruct | MC26826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6S6H5 | 51-161 | NKPKGDGRFGFVDLIFGDLNHSIIELKYINLSGLIKAEYNNWNISLSTNELATLDKVIENEDEIILLKRKYMFWSKDKNRPKITTLD… |
| A0A2Z6QW49 | 146-243 | SAAFELKYFNLIGLLSGESGRWEENPSYQSLFNLDQKLKNESADRLLDRDYIYWCKDEHKHKSIKVKNYIDNGEIQLNTYINILKRG… |
| A0A397SVV4 | 96-218 | None |
| A0A015KNL3 | 140-252 | None |
| A0A015K405 | 67-182 | None |
| A0A397IZZ7 | 858-981 | None |
| A0A2A9NDI4 | 660-769 | None |
| A0A2Z6RRA3 | 303-398 | None |
| A0A2Z6R603 | 12-114 | None |
| A0A397SLK2 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.