DPCstruct | MC26825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1MJY3 | 1-99 | MGIKMSTEDFAKLEGYGAHDENTKAIILKVAGWKPDGTDREIAKFLNTDITNGGLIRGIVTCCLDKQKTIIDQEHNEAVAFQQEIIN… |
| A0A015J4D1 | 1-100 | MGITPLKEDFAALEGYANKTDEERKAIISSAGMEITTIDKNIAQFLGSEDETLGAFIRGIITICIDLNNTNRNKDFEKYIEEYRNSN… |
| U9UFH7 | 1-96 | None |
| A0A2N1N3I2 | 1-124 | None |
| A0A2I1EUT6 | 1-100 | None |
| A0A372QLW6 | 2-80 | None |
| A0A397SV48 | 1-149 | None |
| A0A2N0QU58 | 1-100 | None |
| A0A2H5RUG6 | 1-120 | None |
| A0A2Z6QQ28 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.