DPCstruct | MC26823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 26.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5RDR6 | 1-112 | MNSDNVSSSDESSSSSSSSSSSSSSFSKSSYNTIKAKVFIWSDSELKDVYSINYELTWAEQKDNIVTKLLPPLYKLVNKKYKVSNSD… |
| A0A2N1MI45 | 17-166 | LSTYTPSTRASTRAPSLQGSEIEELRNAVANLSHQLKILTDSSQKSSNKNTIKRSSPIIEDQNMELQPMSSSFKKTLHDEVVQIVNS… |
| A0A397J5G4 | 20-199 | None |
| A0A397I8H6 | 10-171 | None |
| A0A2I1H1J2 | 68-234 | None |
| A0A2I1ES59 | 1-215 | None |
| A0A2H5R4A0 | 133-308 | None |
| A0A2H5QYR6 | 1-112 | None |
| A0A2Z6QU38 | 5-167 | None |
| A0A2Z6RQ07 | 235-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.