DPCstruct | MC26820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 52.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397SN59 | 3-116 | KFNGLNPVVVQALNNLQYRYSGETPEMWCSCVRYPFKKLLEYNPKYFSKNGFIQMVEREYIDGEFKAGRRSFNIYCTVCDSLVFICE… |
| A0A2N1MB02 | 6-113 | DHETPEIWYSCIRDLFRKILEKNLEILSKNEYITICEKFYKGDKVSAQPTNYIIYCNVCDSLVFISGGNYSAYLYYDNHLKRCIFEN… |
| A0A2H5R246 | 1-151 | None |
| A0A2H5T0X8 | 13-115 | None |
| A0A2Z6RDZ5 | 4-117 | None |
| A0A372Q5N8 | 75-218 | None |
| A0A2N1NEE6 | 3-117 | None |
| A0A2H5RZ47 | 1-149 | None |
| A0A2H5QZ61 | 240-354 | None |
| A0A397TU44 | 15-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.