DPCstruct | MC2682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RYG6 | 102-164 | EYAAESRSSELAEELIAFFLEERLYECFAAALYHCYDLLHPHVILELAWKNKITDYAMPYMVQ |
| A0A3B4WHL0 | 1-76 | MQYASESKDTELAEELLSWFLQENKRECFAACLFTCYDLLRPDVVLETAWRHNIMDFSMPYFIQVMREYLSKVGRL |
| A0A3L6GAD8 | 417-479 | None |
| A0A1S8WK17 | 85-158 | None |
| A0A4W5P6Y9 | 351-423 | None |
| A0A3Q4HQQ1 | 1-76 | None |
| A0A811QKC7 | 322-396 | None |
| A0A402G8U7 | 36-98 | None |
| A0A183DI18 | 87-159 | None |
| A0A673G5Z1 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.