DPCstruct | MC26819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 53.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397S087 | 210-345 | YYSSNWVEMKKYQLYNRLNAVVYIVTFIKLHQQGYRIVTFGDWSHMLKCLANPEYHHISKVNNNIVVNFIKSSEYARYMCEKAGKHY… |
| A0A2N1M8D1 | 17-139 | PQSWAEKKKYQLYIRLTTVAYIVTFIKSYQQGYRFVSYGDWSIMLKYLANPEHYRTTKYLNNDNVNFVRTSEYTRYYCKTYGKSYPY… |
| A0A2H5T0X8 | 262-381 | None |
| A0A2H5SSP9 | 842-962 | None |
| A0A2Z6R669 | 120-244 | None |
| A0A372QND2 | 28-130 | None |
| A0A372Q2J2 | 66-174 | None |
| A0A2Z6QFE0 | 222-331 | None |
| A0A397V1Q6 | 305-428 | None |
| A0A397TFF2 | 67-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.