DPCstruct | MC26818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 550 ± 87 aa |
| Standard deviation of domain lengths | 87.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1M867 | 59-600 | FCPKIITTDGINLDTHEKLTDWMNNLYQDDTGEIISYNNLVPISQLKFDTKPFIDEKQPGVANFKEKLTLENWAQNSKYVRLVREFQ… |
| A0A1G7K4F0 | 57-571 | RLLAQSNKPKKSAVEPMPPPDLPAGTTFDLTAPVLQHADVEFRVPSALSVDRGEAAVLPTDIKPEEWMVIAFNSKLIYGYDMRGPAP… |
| A0A2I1EQC1 | 456-1105 | None |
| A0A2Z6R6H7 | 153-833 | None |
| A0A2I1F727 | 86-578 | None |
| A0A2I1EKV8 | 4-546 | None |
| A0A2Z6RDD9 | 4-358 | None |
| A0A397SP67 | 6-570 | None |
| A0A397S1H8 | 291-905 | None |
| A0A2I1EIQ3 | 5-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.