DPCstruct | MC26817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 203 ± 35 aa |
| Standard deviation of domain lengths | 34.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015JYW5 | 7-125 | SDGSAHNPENDCTMYQIIACKNENLNDIYSQLNDVLLEKQMYEYIDIKQYLPIDIMKRYRFIKELQLTFPIGVYRYHQGNYLGTINY… |
| A0A2N1M726 | 2-203 | KKYLDHLETTNNNMKTLYESENPACEPSNNCNIHLISKCNEEIDSRYCILDFDLANREVFNFVDLNLYISNDSIKKHNFICDIQLSV… |
| A0A7S1EI32 | 119-292 | None |
| A0A2Z6R5X5 | 26-204 | None |
| A0A2Z6RAW7 | 228-400 | None |
| A0A2N0QWJ2 | 402-625 | None |
| A0A2Z6RML8 | 7-183 | None |
| A0A2I1FE80 | 2-212 | None |
| A0A2Z6REK7 | 136-377 | None |
| A0A2I1EXI5 | 176-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.