DPCstruct | MC26813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 27.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3QUY6 | 1-122 | EYAFPKPFCSLEPADNKPLISRFVTELGVGRPKLEISTAKRGGREVIEAAIVRRSAPCGSTWYVARKLIGVETKREILYDAVAKAHH… |
| A0A7V2VI83 | 162-355 | VVDDPLSFLPTHLPAADLVLSLGENGGAAQLLPGIVERTGARALIAPVDNVTWLPDGLIRQLRVWMAAIGVSAVFPKPFCSLTENCY… |
| A0A836VRQ4 | 17-195 | None |
| A0A7C3A5S3 | 17-179 | None |
| A0A7K4HFT3 | 7-173 | None |
| A0A1V4YTA0 | 2-143 | None |
| A0A7C3W7P4 | 79-261 | None |
| A0A842LPU5 | 37-213 | None |
| A0A842VWM3 | 69-259 | None |
| A0A842W3T8 | 11-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.