DPCstruct | MC26812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 272 ± 55 aa |
| Standard deviation of domain lengths | 54.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401PBP4 | 24-332 | MAVKKHMFRSSEPETDRTLKYTSQLRVDGLVSRVETPTDLTERFKDRPDFLIYRQASFAKRMRKVKLPGAFQLNYRTIIKITERFAR… |
| A0A1I8PFD9 | 416-615 | FFFSTVRRDSMEYLKVENDRIIVKSKDRRDLCFYQEFEFKPGGEHLKKIIQKFSRNNSIPASKDIAERTFLITQQKILLKFQYAPGA… |
| H2YT26 | 96-367 | None |
| A0A7S0R7H1 | 849-1221 | None |
| A0A7J5ZJ17 | 399-700 | None |
| A0A5A8CLH0 | 824-1148 | None |
| A0A484C0Y7 | 479-783 | None |
| A0A397CSP9 | 1-211 | None |
| A0A6T8P641 | 226-512 | None |
| A5K0A0 | 419-676 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.