DPCstruct | MC2681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 157 ± 2 aa |
| Standard deviation of domain lengths | 2.21 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4WDX7 | 1-160 | MPTHTCPPHTHSHTPELIRAEVEELKSDFNRRIKEVLFNSLFSAYYVAFLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLMSQLLP… |
| A0A0V0V7W5 | 489-641 | LIHACSVVPSQIREEVDVFISDVYNRLKQCLFAAFTTAYYAVFIPCGFAPAYLYIDYVWVAEMSFIVFLTSGTLYLTYLFPIQLCDQ… |
| A0A139WAV5 | 518-675 | None |
| A0A2I2YTX8 | 1-157 | None |
| A0A6J2DEP1 | 222-378 | None |
| A0A6G0TNP9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.