DPCstruct | MC26809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.71 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0020- CL0269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0W313 | 5-134 | VLPEELDVLRQQYADESTKGWVSVQTKFNYAWGSVKSDNRVEVGEGVALLMDIYRTEPTRRRECLYFLAVGHYKLGNYPEAKRYNAM… |
| A0A6L2PR66 | 35-189 | EFQKYEQVYNEQLKKGTVTQKAQFEYAWCLVRSKFSADIRKGIIFLEELYQNGNEEGRRDDLYYLAIGNARIKVGVLMFESVNSVLR… |
| A0A816URY5 | 435-563 | None |
| A0A2P6NAR5 | 32-175 | None |
| A0A7J7GX12 | 140-241 | None |
| A0A7J7QKA1 | 5-131 | None |
| A2F9S9 | 1-148 | None |
| A0A2H9TM83 | 2-102 | None |
| A0A0B7N8J8 | 8-143 | None |
| A0A819XXF5 | 11-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.