DPCstruct | MC26805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 19.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9EW47 | 5-91 | SFNALVAEIAQVGLSAQVSVRGEHLYIGLAIADAPMPEPATNTLRTLLYRIDLAELGLADVRVVHVYGLTAPKQAAWQQKFAIAPLT |
| A0A1Q8Z7Z7 | 4-134 | QNLLDLARRGNIQAIDVLLNRVFRSSGITAKTAVKEGCLHLLLESEQVPNQQTLVPAIRGAIVNLGVNTVDKMVVYGRQSGMSTPAW… |
| A0A251WKR5 | 607-695 | None |
| A0A7C3VJ35 | 13-128 | None |
| A0A261KKC3 | 199-296 | None |
| A0A6P1A728 | 3-122 | None |
| A0A563VXJ9 | 9-135 | None |
| A0A168S1G4 | 100-225 | None |
| K9PZL6 | 6-118 | None |
| A0A0C1Y6R6 | 8-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.