DPCstruct | MC26800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 680 ± 105 aa |
| Standard deviation of domain lengths | 104.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015J6R8 | 1-675 | MENNTLSFTFHILLPENIERNGQPVILGDVKELGSWKNPIVKLRQPFPQNLTYWKSDPVTISVSNFEKIQYKYAIHTSKSMLFGGEE… |
| A0A2I1FH90 | 1-536 | MENNKFIFNVHLPENIEKIGQPVVVGGVVELGMWRTPIVKLRQPYPHDPTYWQSDPVTINIVDKRNIYYKYAIYVPKSSLKKEVIIY… |
| A0A397UH19 | 546-1128 | None |
| A0A015LTE3 | 268-862 | None |
| A0A2N0SGN7 | 1-824 | None |
| A0A397U432 | 299-1144 | None |
| A0A433PUM8 | 62-670 | None |
| A0A372RMI4 | 2-688 | None |
| A0A372RM66 | 6-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.