DPCstruct | MC268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 100 ± 25 aa |
| Standard deviation of domain lengths | 24.86 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GRH8 | 3-82 | TISPKDYLRILQNNTQPVKPDLRLIDDLSSNLKLPNCVINAIIDYVLTKNDNVLSRALTEKVASSLAREGVTTTIDAMEF |
| A0A2U1JWP2 | 13-91 | TVTPEEFLMDLQKGSKPIEADLKLIKEIREIGLSNEAINVLIHYILIKSDMKLNKNYALKIAAHWNRKRVTTADEAMMW |
| A0A832NGG1 | 238-341 | None |
| A0A4R1API8 | 97-181 | None |
| A0A415RL65 | 290-406 | None |
| A0A6C1WCI7 | 130-286 | None |
| A0A1E7DT08 | 43-132 | None |
| A0A372L8M2 | 6-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.