DPCstruct | MC26795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 197 ± 16 aa |
| Standard deviation of domain lengths | 16.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372Q6G4 | 1-197 | MSDFVVHTTMRLQNIVKDPYSFFEAELLEGTDLLNDYQMNKLIQDLEHGTQKALELHQKWLDCWLHLPLSICHLGGKYGREFARSFA… |
| A0A015I629 | 1-224 | MPDKVYEWRKFLQNLVENFEMFFADELSGAVDALSSEEFGVFFDNLEKGINKALEHFEKWFLSWLHLPLVICHLGGDNGKSFASSFH… |
| A0A397UG81 | 131-305 | None |
| A0A2Z6R9H1 | 122-343 | None |
| A0A397SHJ4 | 29-223 | None |
| A0A397V2E9 | 1-198 | None |
| A0A397U6D4 | 85-252 | None |
| A0A2N1MTP9 | 57-255 | None |
| A0A397UND8 | 122-322 | None |
| A0A397VTI3 | 292-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.