DPCstruct | MC26792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7V1G9 | 37-154 | FQINMEPPLQKSLELLRTITVEGNGFVEIDGNEFIVEGTSGLGYRFEFQNPYKMGVECYRSKAAALNSENELCLHPCIDLDDEIIEI… |
| A0A7J4NGQ5 | 184-285 | PWAKSFQLLFEVIDDLGDRAYFVHGAIEVVGSSGHIYRIQPKSGRPYFHVAGQVGEQYQHICIDPVGASNVIFGDVLVTLILSLYDD… |
| A0A075G4S4 | 167-286 | None |
| A0A2V4D8W2 | 277-387 | None |
| A0A2E7G0H0 | 128-235 | None |
| A0A519DFX3 | 1-115 | None |
| A0A519DAF8 | 8-127 | None |
| A0A7C7TXV0 | 375-487 | None |
| A0A7C7CXE5 | 255-382 | None |
| A0A2V4D1J3 | 88-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.