DPCstruct | MC2679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 247 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z3YU87 | 23-265 | DCRIGVRSGHTLLHVTLWHPNWGSAKTAALRSGLFGSAGMTVAPDVSVARELLDAALGSVVAETWIGTVEVTDHSPAHAVTMGGLHA… |
| A0A4Q3XJJ2 | 217-445 | LSDSVLKLDSIELALNETRVGVRRSGTRVDVQVHHPRLEELGEQGRTTFCFLAVDAAVGETMTETWIGELHPSLVPPMDGFGLSGLR… |
| A0A1Y3XRP7 | 793-1038 | None |
| A0A139K6M5 | 641-889 | None |
| A0A4Q2XH90 | 3-230 | None |
| A0A1E3AZU3 | 674-928 | None |
| A0A1Y4TLY2 | 227-476 | None |
| A0A2Z6IBR4 | 610-853 | None |
| A0A2W4IIC8 | 179-410 | None |
| R6BN28 | 227-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.