DPCstruct | MC26789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 143 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W4V504 | 5-173 | QEMDEFFTTADVEYTTPPPRQHKPHVGPRFAPDPQNARRCDLRTDLYMLQPERLNQGGQNNPLKGKLTNCHVSGCERPFSVQKIPHS… |
| A0A4Z2GQ20 | 7-131 | DAMLKEVCTTEQTQYFFETNEPSFRGTIDCENCTRLYHAEKLPKTNLVFIIADAKLTCSSCDTKPLIQDEQQSNGPDPCVLAQNPRY… |
| A0A1B0G4V9 | 191-333 | None |
| A0A1I8ALS8 | 53-166 | None |
| A0A1B6LGI5 | 21-161 | None |
| A0A673H5I2 | 3-138 | None |
| T1GL87 | 6-109 | None |
| A0A6F9CYQ2 | 1-121 | None |
| A0A7R8VME0 | 116-289 | None |
| A0A0K2VK47 | 186-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.