DPCstruct | MC26788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 242 ± 51 aa |
| Standard deviation of domain lengths | 51.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 93.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W4UW72 | 32-267 | LAVGGIASESPLSLPLLRYDVPFLPTLEATAPSGGPVERKTYDTLKAEYLDRLKKLLPLDGVYLMMHGALSVEGMDDAEGDWYEATR… |
| A0A7W0Z3X7 | 2-282 | RIVTGGIAQETNTFQRQPTTLADFARPGFGTLVRGPEILGLEGTGTVYGGAVARARQLEVELVPTTYGSVMPGGRVTREAFDRLRDE… |
| A0A0D2H738 | 2-242 | None |
| A0A4P5UBG3 | 379-661 | None |
| R8BHQ3 | 351-631 | None |
| A0A3M1D9S7 | 152-436 | None |
| A0A4P5SSF6 | 8-289 | None |
| N9QFN0 | 1-158 | None |
| A0A2W7PA27 | 1-209 | None |
| A0A7J4FL51 | 7-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.