DPCstruct | MC2678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A341F2C1 | 2-69 | PALDRQILEHSRRWMLSGMYLRCTACGIGQTASEGNRPFSHDISCVRYSARDYPWQELACILHWVPDQ |
| A0A3M5BQR0 | 20-83 | AVVIDVMVSRWNGRWQMSGEEVRCRGCLAPQWPSNAGEPVRHRQDCPNLAYTFPWQDLSELLQE |
| A0A857JAA6 | 7-80 | None |
| A0A1S2NAB9 | 197-267 | None |
| A0A0H5AKU2 | 109-175 | None |
| A0A4R7WQQ4 | 17-88 | None |
| A0A6A7ZF33 | 73-142 | None |
| A0A502ISG1 | 4-78 | None |
| A0A384YCR1 | 6-74 | None |
| A0A1L7NN36 | 3-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.