DPCstruct | MC26776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 105 ± 27 aa |
| Standard deviation of domain lengths | 26.95 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443LNC7 | 1-71 | MFEVWASNWDALLAFLAVETQWRIAAGVGALIWIGLDYSAVDVAFRRLGIGDDAFAAVQQMERAALDVFAR |
| A0A2G2NNF7 | 12-112 | RQADPGGLASDLAAFGVPAEAASLVSGHDEDYGVLPENWGALQLFLKCSTQWRYAGMSGERTGLDYQAVESVIRMTGVTDIADTFWR… |
| A0A6N3FUF9 | 1-61 | None |
| A0A1I1T9C4 | 6-101 | None |
| A0A4D8PL41 | 25-161 | None |
| A0A7U9EPW5 | 9-122 | None |
| A0A1S9AFP0 | 1-112 | None |
| A0A2W5VA94 | 4-106 | None |
| A0A317E9X0 | 57-189 | None |
| A0A2P4V2W2 | 132-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.