DPCstruct | MC26773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 77 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z4PE04 | 1-75 | MATIHRAHGLRIIIFTDDHEPAHVHAFGDGQAKINLIGLGGAPVLVWAEGMKANDLRRAMQIVRDEQAQFLARWG |
| A0A2E5SPT6 | 1-72 | MPTLLYLNGFKFFFYANDHWPAHVHVLKGERWAKIQLSDLKVVHSSLKHQELRACLGIIESHRSEFLERWNA |
| A0A450YQ60 | 2-74 | None |
| A0A1Z4JGI4 | 1-86 | None |
| F5XEX7 | 1-87 | None |
| C7C580 | 133-220 | None |
| A0A1Q7G4N3 | 1-73 | None |
| A0A354B1G7 | 1-59 | None |
| I4HWD4 | 21-105 | None |
| A0A7H1MYH8 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.