DPCstruct | MC26772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 5.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 43.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0292 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076H6A1 | 3-95 | ESARPPFLTVLISSFTTVFLAELGDKTQLATLLLAAQSGSPWLVFLGAALALIASSLVGVLVGQWLSKVLPPERLELMAGVLMVSLG… |
| A0A0M2Q206 | 19-112 | QSFGRVFWSTFVTILLAELGDKTQLTTLLMSAESQKPWIVFAGAGTALVTTSLLGVLLGRWLASKLQPRTLNLAAGLVLVTIAATLF… |
| A0A0A2AYR0 | 16-108 | None |
| A0A845XAG6 | 6-90 | None |
| A0A1L9QY57 | 1-99 | None |
| A0A6J4VA56 | 29-126 | None |
| A0A7C4CAJ4 | 1-92 | None |
| A0A1G3Q2X7 | 1-102 | None |
| A0A1G1CFY1 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.