DPCstruct | MC26768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A552HXX4 | 15-64 | PQANTWVQLRMLPSPYSFDEALLLCEQDQGRWVAWIPDFGEIILIEGQFE |
| A0A6B3NLL5 | 17-66 | TAFKGLQAGAWIHLEEVPSTFAHHEGLLLCQVSQWEWVMWIPEHGEHLLK |
| A0YMT3 | 54-108 | None |
| A0A2P8WEJ3 | 20-69 | None |
| A0A4V2JP45 | 8-52 | None |
| A0A6H1TZI7 | 19-75 | None |
| A0A1J1LQV1 | 21-77 | None |
| A0A2W7A234 | 28-85 | None |
| A0A846DYM5 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.