DPCstruct | MC26765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 19 aa |
| Standard deviation of domain lengths | 18.56 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1T0L6 | 30-106 | EPEAGEDRKIQLFKNFRSRENVLNITNMVFEDIMSKELGDIDYNTNEYLNLGASYLEIPEQDYTTDIEIIDTSDEDK |
| A0A5C8X4R1 | 230-322 | NGDGTGRRIDLSQNFRSRKEVLSTTNYIFKHMMDEQVGEVNYDESAQLYYGAPYDESDHPVNLKVLVEADQEHSDLTGSEQEAHFIV… |
| W1VQK3 | 65-140 | None |
| A0A6G2CIM9 | 270-336 | None |
| A0A6I1P6B1 | 1-81 | None |
| A0A3D0XX83 | 10-93 | None |
| A0A4R5JI98 | 439-579 | None |
| W4VLB2 | 130-215 | None |
| A0A3A0HPR9 | 15-85 | None |
| A0A2X3GJK0 | 4-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.