DPCstruct | MC2676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416GKI0 | 3-140 | EVKYIEIILENCDEIRVNRENLGWFDMIGLNKEIHRITSNAIVETKSVSGILIHLLKNFEYEDICGNKQSAFKRIKDFHDITAIDVY… |
| A0A4Y9KDB5 | 3-159 | KVKEIELVLENCEYIKVPTMHLANLIIEDIDISVRRIAINSIDKLKTANSIFIEIIKPETIKTLGLFEEDDEESLSCSKRLIQHEDI… |
| A0A316LH98 | 1-129 | None |
| A0A6M1WSU5 | 10-129 | None |
| A0A428MS41 | 5-160 | None |
| A0A6D0ZIV5 | 6-134 | None |
| A0A6B5A279 | 3-122 | None |
| A0A413W7Q8 | 4-139 | None |
| A0A268BVJ8 | 2-130 | None |
| A0A0R2A080 | 30-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.