DPCstruct | MC2675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 209 ± 26 aa |
| Standard deviation of domain lengths | 25.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5B495 | 19-213 | KKSDKRDYLVIEEAKKLQSLDEYPIDFKKLAVLFMLDFDKNGKFSLDDLMKFTDWCGTVTEHLKTDQQSFKSELQAQCTLHMWKQIN… |
| B1N2M0 | 3-172 | RDYNFEFNHLASLYFIDKKKEGYFNREDLLEFTGMFVQFKIKNEYDYLRKFQAYASTEFWKTLQESQGQYQITEWMLRLFKESRGIK… |
| A0A812J5D6 | 359-559 | None |
| A0A0G4HRM8 | 12-255 | None |
| A0A397ALC3 | 2-226 | None |
| I7LX14 | 22-218 | None |
| C1E6B0 | 741-1006 | None |
| L8GRK0 | 26-246 | None |
| A0A4Z1SU00 | 15-217 | None |
| A0A2V0P3J2 | 13-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.