DPCstruct | MC26743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 365 ± 91 aa |
| Standard deviation of domain lengths | 90.99 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.69 |
| Pfam Score | 91.08 |
| Assigned Pfam label(s) | PF12807- PF13236- PF05303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2KWA3 | 4-245 | RLWYKEFQQIQQIPDLRLKLRSLSGLSNDFLSTATSIARLIITEKYLADDAKLIKTSNVGGIAGGVKFISKGILFKFVTDFCLASKS… |
| A0A3P8FRY2 | 5-432 | FRSTDDQFNPHPIQHAYVAHSLIDLLRQLSPGFKRNFESLLKNRAAKHPFERVPTPYQVHSWLAPLVEHSPDSVRKEEAFSSRMACE… |
| D8LF64 | 3-232 | None |
| A0A453PEY2 | 158-648 | None |
| A0A072TRB0 | 1-597 | None |
| A0A2P6NW31 | 209-531 | None |
| A0A0K0E7J3 | 939-1328 | None |
| E7FE02 | 650-1064 | None |
| F4PVD2 | 103-383 | None |
| F4Q0W5 | 261-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.