DPCstruct | MC26742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 69.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0WGD3 | 1-58 | MGYAVAPHHSGVYPVHVQLYEAWKKVWNIRITSTEEYPHLKPARYRRGFIHKNIMVLP |
| A0A183L675 | 1-70 | EHDIPVQIGYSVAPRHSGVYPVYPDLYEAWRTVSNVNVTSTIHYPYGRSSDFRLGFRYNNIQVTFLEKSM |
| A0A7R8CGI5 | 119-178 | None |
| S9WYJ2 | 125-190 | None |
| A0A2K5YYY2 | 1-62 | None |
| L5LXU8 | 195-278 | None |
| A0A482X594 | 118-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.