DPCstruct | MC2674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5C2P5 | 3-88 | EKFTNYTLEHLFGDVWQGEELSLEQRSLITCTILVALNREAEQRIHFPGAKNLGVKREQLEAMITHAAHYAGWPVAASAFRVLAEV |
| A0A838IYH4 | 215-323 | AADVIWGPHEPRIDAGLRALDPVLGDLVRRVAYDEVFSSGTLDLRTRELLALAHLVSLGADGELRTHLHGALRAGATPEELRSLLAH… |
| A0A2Z6I9K7 | 136-274 | None |
| A0A017S122 | 7-116 | None |
| A0A7I0DPU2 | 7-104 | None |
| A0A537UQQ5 | 69-207 | None |
| A0A370TMU2 | 456-598 | None |
| A0A2A6M5Z9 | 271-403 | None |
| A0A0W0SWV5 | 7-119 | None |
| A0A2A5RJU8 | 4-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.