DPCstruct | MC26738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 307 ± 66 aa |
| Standard deviation of domain lengths | 66.33 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 89.70 |
| Assigned Pfam label(s) | PF19257- PF14443- CL0306- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183L2S7 | 62-383 | TKPASRERDVHPSSSDQRRVDKKRSHVLNRDDHSIKKSPNRDRRRTPVDSVSTRHSSPTTDLYCRTPINPKRMLNVKEYLFSDLQRR… |
| A0A7J7TRW7 | 20-256 | SPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMED… |
| A0A1I8GUZ2 | 42-398 | None |
| A0A6N2NDZ0 | 16-258 | None |
| A0A6P6KVF6 | 30-293 | None |
| A0A183VJ51 | 34-363 | None |
| A0A564Y663 | 60-401 | None |
| A0A1D6LSU2 | 481-728 | None |
| A0A5K3F5F6 | 60-393 | None |
| L1IE93 | 1-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.