DPCstruct | MC26737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183L0J5 | 1-140 | MVIRNLQSYLNRISRQQEPLFAVDLMLAGTDVVGNPQPAELYRLVIQELRDAIESTRVFVRWYRGSCVIAPGVKIDGSEDLHYFTFY… |
| A0A2C9KIC7 | 151-275 | MVLKNLRWFIYHFKRDEPYFSVEALLAPPDVILVPQSNDIYNTAMSSVRDMVARTKRFIRWLQGSCTEAPPQKVKFQDEPYIFSYYT… |
| A0A7J7J9K5 | 742-847 | None |
| A0A7J6QJ41 | 20-145 | None |
| A0A834DIA3 | 471-593 | None |
| U6K4I5 | 853-983 | None |
| A0A1A9XJL4 | 320-453 | None |
| H2NJ27 | 589-707 | None |
| A0A817CXS3 | 202-331 | None |
| A0A183Q2I5 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.