DPCstruct | MC26735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 95.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W7LKV1 | 1-78 | MKIGNLEKCFFEASHSGAKYVGVKIQMQGFPKPEIIINEHENFDSKFAYYKKAYNDDLTLKTFNGVKIVGFTYGDSFE |
| A0A0J6L0X0 | 1-84 | MELTLEGLEQCFNEANKEGSEFVAVVIQMEGYDENEVIINPHYNIVSKLEYYKKTYDENLSHKFAQGIIIVGFTHGYSFLSIQS |
| A0A843GN12 | 1-72 | None |
| A0A0C2RVG2 | 1-81 | None |
| K5A2P7 | 64-143 | None |
| A0A5S4W531 | 1-81 | None |
| A0A2B4BSQ0 | 1-78 | None |
| A0A7U4LNE1 | 33-114 | None |
| A0A074LIT9 | 5-77 | None |
| A0A7U9SNP1 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.