DPCstruct | MC26733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8QYH5 | 2-84 | YKYKIKEFMDQLPVIEYRKLNTQLHRVIGVSRNTLINYSLIKITSKKDVPYSTIRKLEIIFGVKYGDLTNQNITCDHYKKIID |
| A0A7L5DXK2 | 1-90 | MTESKFKYRINQLLNTLSVTDYRKAIRIIPKQLGVSEKNLANYRNIKMDDKQDIPHEKVAMLEKLFNVHPGELQNFVLVMNPITEII… |
| A0A4V3E6B7 | 2-85 | None |
| A0A4R6IAM4 | 25-115 | None |
| A0A2E6SUR2 | 1-108 | None |
| A0A1D7QAN0 | 2-85 | None |
| W6TVZ0 | 18-101 | None |
| F0SA86 | 1-82 | None |
| A0A1W2CMW8 | 8-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.