DPCstruct | MC26731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 20 aa |
| Standard deviation of domain lengths | 19.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846EWW4 | 2-211 | IEPISGFRLFILYPLIPWIGVMALGYAFGTLFEMEKERRLQLLINIGLSTIAAFIIIRATNIYGDPNPWSIQSNFPNTLLSFINCHK… |
| A0A7Y3FWC4 | 353-548 | QLVIDTGIFGNPLSVLFLLPKTGRVWFNLYPIFPWLCIVLIGMAFGKEILKNKEKAFQKLLYAGLISLTVFVIVRFTGGFGNLKDPA… |
| A0A855HMW7 | 2-179 | None |
| A0A7Y0NWC6 | 34-242 | None |
| A0A261XZV6 | 166-401 | None |
| A0A2V7HBG5 | 1-192 | None |
| A0A4Q7G0U3 | 1-179 | None |
| A0A2V9RLP2 | 89-298 | None |
| A0A2K2G3S8 | 1-164 | None |
| A0A0L0S6Z0 | 160-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.