DPCstruct | MC2673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 227 ± 24 aa |
| Standard deviation of domain lengths | 23.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V5SJJ8 | 47-266 | RRSDAWWWLYLPLVLFAALLTISLAWPDFYRAYILPEGYGFLELGHFLIPFAAAILSLRLLLLRLVRESWPLWLFILVFGLGNFYIA… |
| A0A7V6BZ98 | 166-395 | ASGFKLIEKSRLNIALSSSLILVLLGYVIYIFSGHTNQLGFLFDEDTVAENLQAVFYGFAGLLFLSKFMSARQKIKRKDIFYLLFAA… |
| A0A662Q423 | 10-228 | None |
| A0A2E9WMI7 | 17-220 | None |
| A0A3M1GWC7 | 32-256 | None |
| A0A6L3EP30 | 9-225 | None |
| A0A532DDL5 | 18-268 | None |
| U2EA59 | 2-176 | None |
| A0A7C1NNT8 | 11-205 | None |
| A0A8A3MNJ3 | 8-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.