DPCstruct | MC26729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 153 ± 29 aa |
| Standard deviation of domain lengths | 29.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3DTB2 | 11-190 | LDLITVVDNVPLDFETNHAPYYRFLLAPDPRTHGFIHPNTVAKLPWPAAFLVDHTARTVTITQPPAGTSPSTHANAALQQAVDAAVA… |
| A0A4X2MF95 | 48-160 | TGSSGFQCLPLVVEGQQVGLVVPAVARELRSFPDVFVEVAEGLEVRGGHCPEERTEAVAGVLAQLRAQGRLARLSKWRDEVYEVRPS… |
| A0A6A6YZA8 | 3-151 | None |
| A0A395GLY4 | 1-165 | None |
| H0EMR1 | 5-155 | None |
| A0A3Q0J9V4 | 15-133 | None |
| B6K414 | 17-120 | None |
| A0A0K6FUF9 | 3-203 | None |
| A0A6A5D8L8 | 26-148 | None |
| A0A2P5DJ70 | 3-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.