DPCstruct | MC26728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 181 ± 21 aa |
| Standard deviation of domain lengths | 20.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X2LYY9 | 1-217 | MGRKRVRGGAGGGLGRALIKERNLQNRLQRRRDTWVSAWRSPSAPCWGRGGIRTQGPEVAALTWACPPQLHAKELDDGGAWGRVDPR… |
| A0A2G8L6Y0 | 1-177 | MGKKKDANTAIGRSIIKSRQRKSRPGHTNSWHHTSDLDDGYDWNRINLNSVTEQNSLDEFLTTAELAGTQFTAEKLNITVINDNYSG… |
| A0A0D2WVQ9 | 86-261 | None |
| A0A1J1HHS7 | 644-828 | None |
| A0A7R8W9V1 | 1-177 | None |
| A0BRA9 | 1-205 | None |
| A0A819SGS7 | 1-140 | None |
| A0A6S7FNK1 | 1-168 | None |
| A0A4Q4ST50 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.