DPCstruct | MC26725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 139 ± 28 aa |
| Standard deviation of domain lengths | 28.40 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X2LTQ9 | 2-140 | ITYWDLISHDEMFFDIYKIQEITNRLCLEVEGKMVSRTEGTIDDSFIGGNTSVKGPEGEGTDATAIPGVDIVINHHLVKPFMRRTAE… |
| A0A5N6IXS8 | 2-146 | YVYKDVINGGKLFVDLSPISEVDDFVYEVECPKEGDILEIFNIQPVEMDKNTYHQYTRKYLRRLTHHMLSKSDNREEVLAFGKSFDA… |
| A0A669CT77 | 1-149 | None |
| A0A7R8XKS6 | 289-450 | None |
| A0A3B5QQY5 | 1-161 | None |
| J3JXV5 | 1-97 | None |
| A0A5N3WHU4 | 1-99 | None |
| A0A7R9Q8H2 | 1-165 | None |
| A0A6U0WMX4 | 23-179 | None |
| A0A5N6WLB4 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.