DPCstruct | MC2672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 196 ± 44 aa |
| Standard deviation of domain lengths | 44.15 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F0F6R9 | 22-192 | KPLLMPALATGLIWGAPQRRSPAIVLGVVALFFSWVGDVTIPWWFVVGLVFFLLAHITYLVLFVSRIAVRRVQWWAIAYAVWLVVLL… |
| A0A7V5WPJ4 | 11-182 | LTTILIVIAGLSGLNNSYSVAIFIGLMFSLFGDIFLLFKTKFIWGLINFLIAHIIYIKAFYSGFSSLGMYVALPLLIYAAIMLFQLW… |
| Q86NF6 | 7-217 | None |
| A0A226EYJ7 | 156-372 | None |
| A0A447CMY8 | 39-263 | None |
| A0A1Q3YFH7 | 11-168 | None |
| A0A182FJ84 | 33-215 | None |
| A0A1D2NN13 | 59-266 | None |
| W7Z922 | 3-141 | None |
| B8B425 | 196-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.