DPCstruct | MC26715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 206 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1QSM4 | 126-329 | EPWWIDIYKMEWQAKKRNVYERLRGVYNDDVVNGILNVFDEFISYIDRFREYWIENGIEVKEIIDNLVGGKAEVVIWENMSGLSVYG… |
| A0A831V8A2 | 28-230 | FPAWEVYIEYEARRIAEAFPLTEEERRALLGFGEVMKGLLQRAHEYTRTKLTSIYDAINNNNYKLEGGRLYAPDGAWMHVGEEPHVV… |
| A0A7C2LB48 | 26-237 | None |
| E1QR75 | 2-239 | None |
| E1QP16 | 2-190 | None |
| E1QNC5 | 62-273 | None |
| A0A7C1GDX3 | 33-218 | None |
| A0A101XAB1 | 11-203 | None |
| A0A831V731 | 46-204 | None |
| A0A830DZ96 | 6-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.