DPCstruct | MC26714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 59.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831USG0 | 14-75 | GYSTVGAGEDAERLAALIKALTGVKPRMRRVGSKIKITCSEKHLEGFALYAELYEAIRRWLE |
| A0A124IQW6 | 6-70 | ARADAPGGREADAERLSALIKALTGREPKVYRMKNGAIIIMCGREHLDGFMRYAELADAIEKWLK |
| A0A2J2HBV2 | 316-383 | None |
| A0A831YID4 | 829-911 | None |
| A0A831YGL1 | 32-99 | None |
| A0A831YF69 | 63-141 | None |
| A0A831PDX9 | 4-59 | None |
| A0A7C5T8S6 | 326-406 | None |
| A0A831VDJ8 | 475-558 | None |
| A0A831XXA6 | 129-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.