DPCstruct | MC26711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0X7I2 | 224-318 | MGGLLTINPIWNLGPYKPSQVSAGSQPDFYMMWTEGLARIWPAWEFYPFGHTIPAVVWVAVIMGVVFGLLIAYPFIEKKVTGDDAHH… |
| A0A2P8B1P9 | 116-212 | GLVQINPVWQYGPFAPAQSTAPAQPDWYVAWGDGALRLFPPWEIHIAGHLVPAPFFPGVVLGGVTFGALYAWPFLERWCTGDHRQHH… |
| A0A2P9IPM6 | 158-257 | None |
| A0A2A3HV78 | 53-164 | None |
| A0A401MUW9 | 24-126 | None |
| A0A1V3WZ46 | 1-117 | None |
| A0A840QAS6 | 57-154 | None |
| A0A6N9Y7U1 | 66-149 | None |
| A0A852UWU3 | 89-196 | None |
| A0A511DJ34 | 5-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.