DPCstruct | MC26710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 190 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 41.76 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0317- PF15135 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4X1V0B7 | 38-244 | DHTGVGRSIVYGVKQKDGQELSNDLDAQAVATSLLPLTEANLRMFQRAQEDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRK… |
| A0A7J7TZ09 | 2-166 | FQRAQEDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYEPVPCDKMWGVAEFHCPKCRHNFRGWAQMGSSSPCYGCGFPV… |
| A0A0L8G423 | 11-185 | None |
| A0A5E4AAB5 | 1-195 | None |
| F7FBR3 | 139-357 | None |
| A0A2G8LH43 | 93-266 | None |
| A0A485NXQ7 | 22-195 | None |
| A0A8B6C256 | 70-260 | None |
| A0A4W3HPM0 | 86-253 | None |
| A0A444UZ73 | 86-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.