DPCstruct | MC2671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 169 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4G1M2 | 1-173 | MTLVVAQAGHSVEHVVQMTQLLVQDLPGVAAQGFLVAANQESVHAAWSLGVMLGVALLFAAGLRGPWAWALLAWSLLHAGEHVYLFA… |
| A0A2K8WRT4 | 2-136 | WYVIWFHLFEHFTQIIQVYILGWERSQSLGIIGLLFPILIRSEILHYLFSLFNVIFFLPLARQNTYYYTATILAILHHNEHFGLLLQ… |
| A0A7C1IUI3 | 2-167 | None |
| A0A535XC90 | 50-212 | None |
| R1FY53 | 27-226 | None |
| A0A6L3EPN7 | 21-215 | None |
| A0A7J3WEZ9 | 24-180 | None |
| A0A1Q7AEC3 | 3-180 | None |
| A0A7J9ZZD5 | 20-193 | None |
| A0A1Q7I058 | 32-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.